T170A_MOUSE Q9D342
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D342
Recommended name：Transmembrane protein 170A
EC number：
Alternative names：
Cleaved into：
GeneID：66817
Gene names (primary )：Tmem170a
Gene names (synonym )：D8Bwg1414e Tmem170
Gene names (ORF )：
Length：144
Mass：15224
Sequence：MEREGSGGGGGSAGLLQQILSLKLVPRVGNGTLCPNSTSLCSFPEMWYGVFLWALMSSVFFHVPAGLLALFTLRHHKYGRFMSVSILLMGIVGPITAGILTSAAIAGVYRAAGKEMIPFEALTLGTGQTFCVVVVSFLRVLATL
Tissue specificity：
Induction：
Developmental stage：
Protein families：TMEM170 family