VMA21_MOUSE   Q78T54


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q78T54

Recommended name:Vacuolar ATPase assembly integral membrane protein Vma21

EC number:

Alternative names:

Cleaved into:

GeneID:67048

Gene names  (primary ):Vma21

Gene names  (synonym ):

Gene names  (ORF ):

Length:101

Mass:11365

Sequence:MERLDKAALNALQPPEFRNENSLAATLKTLLFFTALMITVPIGLYFTTKAYIFEGALGMSNRDSYFYAAIVAVVAVHVVLALFVYVAWNEGSRQWREGKQD

Tissue specificity:

Induction:

Developmental stage:

Protein families:VMA21 family


   💬 WhatsApp