ZN787_MOUSE   Q8BIF9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BIF9

Recommended name:Zinc finger protein 787

EC number:

Alternative names:

Cleaved into:

GeneID:67109

Gene names  (primary ):Znf787

Gene names  (synonym ):Zfp787

Gene names  (ORF ):

Length:381

Mass:40477

Sequence:MELREEAWSPGPLDSEDQQMASHENPVDILIMDDDDVPSWPPTKLSPPQSAPPPGPPPRPRPPAPYICTECGKSFSHWSKLTRHQRTHTGERPNACTDCGKTFSQSSHLVQHRRIHTGEKPYACSECGKRFSWSSNLMQHQRIHTGEKPYTCPDCGRSFTQSKSLAKHRRSHSGLKPFVCPRCGRGFSQPKSLARHLRLHPELSGPGVAAKVLAASVRRAKAPEEATAADGEIAIPVGDGEGIIVVGPPGDGAAAAAALAGVGTRATGTRSRRAPAPKPYVCMECGKGFGHGAGLLAHQRAQHGDGLGVAVGEEPAHICVECGEGFVQGAALRRHKKIHAVGAPSVCSSCGQSFYRAGGEDDGEDQSAGARCAECRGGEAR

Tissue specificity:

Induction:

Developmental stage:

Protein families:Krueppel C2H2-type zinc-finger protein family


   💬 WhatsApp