CH037_MOUSE   Q3UJP5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3UJP5

Recommended name:Protein C8orf37 homolog

EC number:

Alternative names:

Cleaved into:

GeneID:67157

Gene names  (primary ):

Gene names  (synonym ):

Gene names  (ORF ):

Length:209

Mass:23848

Sequence:MAKDLDELLDEVETKFCRLDPLRLDLGERPKGDGGGGSHSGDRNGAQEKETLRSTETFKKEDDLDSLINEIFEEPDFDRKSFQKFKSKSSSNTCVRAPMQGVSKSCSPVYLSGSAIPCGIGTNTSQRACDRLRCVACDFRIVSYNDYMWDKSCDYLFFRNNMPEFHKLKTKLIEKKGARAYACQCSWRTVEELTDLQTDHQLRWVCGKH

Tissue specificity:Expressed in multiple tissues, including the brain, kidney, lung, spleen, heart, trachea and testis (PubMed:29440555). Expressed in the retina (at protein level) (PubMed:22177090, PubMed:29440555). {ECO:0000269|PubMed:22177090, ECO:0000269|PubMed:29440555}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp