UBL4B_MOUSE   Q9CQ84


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CQ84

Recommended name:Ubiquitin-like protein 4B

EC number:

Alternative names:

Cleaved into:

GeneID:67591

Gene names  (primary ):Ubl4b

Gene names  (synonym ):

Gene names  (ORF ):

Length:188

Mass:20518

Sequence:MFLTVKLLLGRRCSLKVSGKESVATLKKLVSQHLQVPEEQQHLLFRGQLLADDKYLSDYSIGPNASINVIMRPPEDAALDKTHQTQPLWLQLGQVLDKHFGAKDAKTVLGFLRQEHEERLQRLSLEALEQLVGQLLAQQQLDELAEEKEAPAVASELEQNNGGGGGGGGTGGEGGGKKEEEEGEEADQ

Tissue specificity:Expressed specifically in post-meiotic male germ cells of the testis. Abundantly expressed in stage 14-16 spermatids. {ECO:0000269|PubMed:16872915}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp