RB39B_MOUSE   Q8BHC1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BHC1

Recommended name:Ras-related protein Rab-39B

EC number:

Alternative names:

Cleaved into:

GeneID:67790

Gene names  (primary ):Rab39b

Gene names  (synonym ):

Gene names  (ORF ):

Length:213

Mass:24636

Sequence:MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVIKSERRCLC

Tissue specificity:Specifically expressed in neuron and neuronal precursors in the brain. Expression is high in all regions of the brain with highest levels observed in the hippocampus. {ECO:0000269|PubMed:20159109}.

Induction:

Developmental stage:

Protein families:Small GTPase superfamily, Rab family


   💬 WhatsApp