F229A_MOUSE   B2KGE5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:B2KGE5

Recommended name:Protein FAM229A

EC number:

Alternative names:

Cleaved into:

GeneID:68233

Gene names  (primary ):Fam229a

Gene names  (synonym ):

Gene names  (ORF ):

Length:128

Mass:13171

Sequence:MQSSPSTLGPGRAADTCQAPPGPERPPVARARAVASSLGPASASGRVPRGLDMSAQETPQGRRFPIEAGDSPGLASAPESQDSPEPVATDQNPVRPLRRCPGCHCLTLLHVPIDVYLAMGGSPRARAT

Tissue specificity:

Induction:

Developmental stage:

Protein families:FAM229 family


   💬 WhatsApp