RBL2A_MOUSE E9Q9D5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:E9Q9D5
Recommended name：Rab-like protein 2A
EC number：
Alternative names：
Cleaved into：
GeneID：68708
Gene names (primary )：Rabl2
Gene names (synonym )：Rabl2a
Gene names (ORF )：
Length：223
Mass：25610
Sequence：MAGDRNRHCELEQEKYDTHENVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGKTILVDFWDTAGQERFQSMHASYYHKAHACIMVFDVQRKITYKNLGTWYAELREFRPEIPCILVANKIDADIQMTQKNFSFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVAYKESSQDFMDEVLQELENFKLEQKEEDTSGQEQSDTTKSPSPS
Tissue specificity：Isoform 2 is expressed in the testis and localizes to the mid-piece of the sperm tail (at protein level). Isoform 2 is expressed at higher levels in testis than isoform 1. Isoform 1 and isoform 2 are widely expressed and notably within other tissues containing motile cilia including the lung, trachea, brain, ovary and kidney. {ECO:0000269|PubMed:23055941}.
Induction：
Developmental stage：
Protein families：Small GTPase superfamily, Rab family