ZCHC9_MOUSE   Q8R1J3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R1J3

Recommended name:Zinc finger CCHC domain-containing protein 9

EC number:

Alternative names:

Cleaved into:

GeneID:69085

Gene names  (primary ):Zcchc9

Gene names  (synonym ):

Gene names  (ORF ):

Length:271

Mass:30488

Sequence:MTRWARVTTSNSKRPLSATSWEDMKKGSVERADQSLPNRKQCQSSRLPLRNDSPQAKRKKNKKKKEYLNEDVNGFMEYLKQNSQVLHNGQLIAADSQEVREEIAVALKKDSRREGRRLKRQAAKKNAMVCFHCRQPGHGIADCPAVLESQDMGTGICYRCGSTEHEMSKCRANVDPALGEFPFAKCFVCGEMGHLSRSCPDNTKGVYADGGSCKLCGSVEHFKKDCRENQNSDRIITVGRWAKGMSADYEDVLDVPKLQKPKTKVPKVVNF

Tissue specificity:Detected in brain cortex and in testis. {ECO:0000269|PubMed:18721783}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp