CS081_MOUSE D3Z070
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:D3Z070
Recommended name：Putative uncharacterized protein C19orf81 homolog
EC number：
Alternative names：
Cleaved into：
GeneID：69349
Gene names (primary )：
Gene names (synonym )：
Gene names (ORF )：
Length：196
Mass：22145
Sequence：MQPEVEPLISPNLGAPGSHRETGSFLVDLESMEESMSRSLGKPAKSSKQYLRQVISEYEALDRELPCIRKFSEPPSAQPLCLCMETSEDFTHVEVLQALEAELPGAMESGRVNSIRYENMNVICGTAGRRDRWLITVTDFQTRSRLLRSGLTLRGTAYPLVRHDDLLLGDYRLHLRRSLVRRRMLEALGAEPADED
Tissue specificity：
Induction：
Developmental stage：
Protein families：