M4A6B_MOUSE Q99N09
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99N09
Recommended name：Membrane-spanning 4-domains subfamily A member 6B
EC number：
Alternative names：
Cleaved into：
GeneID：69774
Gene names (primary )：Ms4a6b
Gene names (synonym )：
Gene names (ORF )：
Length：244
Mass：26860
Sequence：MIPQVVTSETVAMISPNGMSLPQTDKPQPFHQWQDSLKKHLKAEIKVMAAIQIMCAVMVLSLGIILASVPSNLHFTSVFSVLLKSGYPFIGALFFIVSGILSIVTETKSTKILVDSSLTLNILSVSFAFMGIIIISVSLAGLHPASEQCLQSKELRPTEYHYYQFLDRNECFAAKSVLAGVFSLMLISTMLELGLAVLTAMLWWKQSHSNIPGNVMFLPHSSNNDSNMESKVLCNPSYEEQLVC
Tissue specificity：Expressed at high levels in thymus, spleen, and peripheral lymph nodes, with less abundant levels in non-lymphoid tissues.
Induction：
Developmental stage：
Protein families：MS4A family