CL12B_MOUSE   Q149M0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q149M0

Recommended name:C-type lectin domain family 12 member B

EC number:

Alternative names:

Cleaved into:

GeneID:71183

Gene names  (primary ):Clec12b

Gene names  (synonym ):

Gene names  (ORF ):

Length:275

Mass:31186

Sequence:MSDEVTYATLMLQDSARVRGNQDGNNLRKEGHPAQSSLWRGAALSLMTLCLVLVTGLVTLATMFLQVSNDINSDSEKLSQLQKSIHPQQDNLSESLNSSRKSLTEESLQSQISALLERQEQMATKLCKEFLIHASDHKCNPCPKTWQWYGNSCYYFSINEEKSWSDSRKDCIDKNATLVKIDSTEERDLLQSQLSLTFSFFWLGLSWNSSGRNWLWEDGSFPPPTLFSDKELASFNGSRDCAYFERGNIYASRCSAEIPWICEKTASLVKTEDLD

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp