PSCA_MOUSE   P57096


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P57096

Recommended name:Prostate stem cell antigen

EC number:

Alternative names:

Cleaved into:

GeneID:72373

Gene names  (primary ):Psca

Gene names  (synonym ):

Gene names  (ORF ):

Length:123

Mass:13478

Sequence:MKTVFFLLLATYLALHPGAALQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVNGAHTLKPPTTLGLLTVLCSLLLWGSSRL

Tissue specificity:Predominantly expressed in prostate. Also found in spleen, liver, lung, prostate, kidney and testis. Expressed in brain cortex; expression is increased in transgenic mouse model of Alzheimer disease (at protein level). {ECO:0000269|PubMed:25680266}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp