C42S2_MOUSE   Q8BGH7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BGH7

Recommended name:CDC42 small effector protein 2

EC number:

Alternative names:

Cleaved into:

GeneID:72729

Gene names  (primary ):Cdc42se2

Gene names  (synonym ):

Gene names  (ORF ):

Length:84

Mass:9223

Sequence:MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG

Tissue specificity:Detected in spleen, thymus and lung (at protein level). {ECO:0000269|PubMed:15840583}.

Induction:

Developmental stage:

Protein families:CDC42SE/SPEC family


   💬 WhatsApp