PURG_MOUSE Q8R4E6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R4E6
Recommended name：Purine-rich element-binding protein gamma
EC number：
Alternative names：
Cleaved into：
GeneID：75029
Gene names (primary )：Purg
Gene names (synonym )：
Gene names (ORF )：
Length：350
Mass：39938
Sequence：MERARRRGGGGSGGGRGRGGKNVGGPGLSKSRLYPQAQHSHYPHYSASATPNQSGGTSEIQELASKRVDIQKKRFYLDVKQSSRGRFLKIAEVWIGRGRQDNIRKSKLTLSLSVAAELKDCLGDFIEHYAHLGLKGHRQEHGQSKEQVSRRRQKHSAPSPPVSVGSEEHPHSVLKTDYIERDNRKYYLDLKENQRGRFLRIRQTMMRGTGMIGYFGHSLGQDQTIVLPAQGMIEFRDALVQLIEDYGEGDIEERRCGDDDPLELPEGTSFRVDNKRFYFDVGSNKYGIFLKVSEVRPPYRNTITVPFKAWTRFGENFIKYEEEMRKICNSHKEKRMDGRRASGEEQECLD
Tissue specificity：Isoform 1 is expressed in testis. Isoform 2 is expressed in blastocyst and kidney. {ECO:0000269|PubMed:12034829}.
Induction：
Developmental stage：
Protein families：PUR DNA-binding protein family