IFT43_MOUSE Q9DA69
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9DA69
Recommended name：Intraflagellar transport protein 43 homolog
EC number：
Alternative names：
Cleaved into：
GeneID：76411
Gene names (primary )：Ift43
Gene names (synonym )：
Gene names (ORF )：
Length：206
Mass：23501
Sequence：MDDLLDLGEERRRSSATSGAKMGRRAHQESTQAENYLNSKNSSLTQTGEAPPPKPPRRQGGWADDSMKMAKLGKKVSEEMEDHRLRQQNLMGSDDDDIPVIPDLEDVQEEDFVLQVASPPSIQVNRVMTYRDLDNDLMKYSAFQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLYTEVSSELLTEWDLLRAEKEDPVGPSRYI
Tissue specificity：Expressed in the retina, iris-ciliary body, lens and cornea. Higher expression is observed in the retina, predominantly in the photoreceptor outer segment. {ECO:0000269|PubMed:28973684}.
Induction：
Developmental stage：
Protein families：IFT43 family