RL18A_MOUSE P62717
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P62717
Recommended name：60S ribosomal protein L18a
EC number：
Alternative names：
Cleaved into：
GeneID：76808
Gene names (primary )：Rpl18a
Gene names (synonym )：
Gene names (ORF )：
Length：176
Mass：20732
Sequence：MKASGTLREYKVVGRCLPTPKCHTPPLYRMRIFAPNHVVAKSRFWYFVSQLKKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYREYRDLTTAGAVTQCYRDMGARHRARAHSIQIMKVEEIAAGKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTFF
Tissue specificity：
Induction：
Developmental stage：
Protein families：Eukaryotic ribosomal protein eL20 family