YD286_MOUSE   Q9CWB7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CWB7

Recommended name:Glutaredoxin-like protein C5orf63 homolog

EC number:

Alternative names:

Cleaved into:

GeneID:77422

Gene names  (primary ):

Gene names  (synonym ):

Gene names  (ORF ):

Length:115

Mass:13430

Sequence:MLWFQGKSLQIAKSSFGLLRNLSASNRALPVLTLFTKAPCPLCDEAKEVLQPYKDRFILQEVDITLPENSTWYERYKFDIPVFHLNGQFLMMHRVNTSKLEKQLRKLEQQVLATN

Tissue specificity:

Induction:

Developmental stage:

Protein families:Glutaredoxin family, YDR286C subfamily


   💬 WhatsApp