KLD8B_MOUSE   Q9D2D9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D2D9

Recommended name:Kelch domain-containing protein 8B

EC number:

Alternative names:

Cleaved into:

GeneID:78267

Gene names  (primary ):Klhdc8b

Gene names  (synonym ):

Gene names  (ORF ):

Length:354

Mass:37592

Sequence:MAAGGGRAFAWQVFPPMPTCRVYGTVAHQDGHLLVLGGCGRAGLPLDTAETLDMGSHTWLALAPLPTARAGAAAVVLGKQVLVVGGVDEVQSPVAAVEAFLADEGRWERRATLPQAAMGVATVERDGMVYALGGMGPDTAPQAQVLVYEPRRDCWLSLPSMPTPCYGASTFLHGNKIYVLGGRQGKLPVTAFEAFDLETRTWTRHPSLPSRRAFAGCAMAEGSVFSLGGLQQPGPHNFYSRPHFVNTVEMFDLEHGSWTKLPRSLRMRDKRADFVVGSLGGNIVAIGGLGNQPCPLASVESFSLARRRWEVLPAMPTARCSCSSLQAGPRLFVIGGVAQGPSQAVEALCLRDGV

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp