CE024_MOUSE   Q80X32


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q80X32

Recommended name:UPF0461 protein C5orf24 homolog

EC number:

Alternative names:

Cleaved into:

GeneID:78521

Gene names  (primary ):

Gene names  (synonym ):

Gene names  (ORF ):

Length:188

Mass:20139

Sequence:MMHPVAGSNPAFCGPGKPSCLNEDAMRAADQFDLYSSQQNKYSHTVSHKPMVCQRQDPLNETHLQPTSGRNIEIKDELKKKKNLNRSGKRGRPSGTTKSAGYRTSTGRPLGTTKAAGFKTSPGRPLGTTKAAGYKVSPGRPPGSIKALSRLADLGYGCGTAAFPYPMMHSRVVHGLQETSGEVKPPSE

Tissue specificity:

Induction:

Developmental stage:

Protein families:UPF0461 family


   💬 WhatsApp