JDP2_MOUSE   P97875


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P97875

Recommended name:Jun dimerization protein 2

EC number:

Alternative names:

Cleaved into:

GeneID:81703

Gene names  (primary ):Jdp2

Gene names  (synonym ):Jundm2

Gene names  (ORF ):

Length:163

Mass:18675

Sequence:MMPGQIPDPSVTAGSLPGLGPLTGLPSSALTTEELKYADIRNIGAMIAPLHFLEVKLGKRPQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELKLERQQLILMLNRHRPTCIVRTDSVRTPESEGNPLLEQLDKK

Tissue specificity:Ubiquitously expressed in all adult tissues tested as well in embryos. {ECO:0000269|PubMed:11231009}.

Induction:

Developmental stage:

Protein families:BZIP family, ATF subfamily


   💬 WhatsApp