FPRS7_MOUSE   Q71MR7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q71MR7

Recommended name:Formyl peptide receptor-related sequence 7

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):Fpr-rs7

Gene names  (synonym ):

Gene names  (ORF ):

Length:338

Mass:38141

Sequence:MEANFSIPQNGSEVVFYDSTTSRVICIFLVVVLSITFLLGVIGNGLVIYVAGFRMTHTVTTICYLNLALSDFSYMTSLPFQITSIVMNGEWLFGWFLCKFVHMIINVNLFLSIFLITFIAMDRCICVLHPVWAQNHRTVNLARKVILGSWILVLMLIFPHFFFLTTVKDESGKVHCICNFESWAATPEEQVNMSMTVSLISVTLSFIVGFSIPMIFIVICYGLMAAKIGRRGLVNSSRPLRVLTAVAFSFFVCWFPFQLIFLLGNIGNKETQNNIDAWVNPASTLASFNSCLNPILYVFLGQQFRERLIYSLSASLERALREDSALNSDKIRNLSSQT

Tissue specificity:Expressed exclusively in vomeronasal organ (PubMed:19387439, PubMed:19497865). Expressed in 0.8 % of a subset of sensory neurons located in the apical layer of the vomeronasal organ. Each neuron appears to express only one receptor gene. Expressed in heart, liver, lung, spleen smooth muscle and pancreas (PubMed:12459252). {ECO:0000269|PubMed:12459252, ECO:0000269|PubMed:19387439, ECO:0000269|PubMed:19497865}.

Induction:

Developmental stage:

Protein families:G-protein coupled receptor 1 family


   💬 WhatsApp