ZNT8_MOUSE   Q8BGG0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BGG0

Recommended name:Zinc transporter 8

EC number:

Alternative names:(ZnT-8) (Solute carrier family 30 member 8)

Cleaved into:

GeneID:239436

Gene names  (primary ):Slc30a8

Gene names  (synonym ):Znt8

Gene names  (ORF ):

Length:367

Mass:40223

Sequence:MEFLERTYLVNDQATKMYAFPLDRELRQKPVNKDQCPGDRPEHPEAGGIYHCHNSAKATGNRSSKQAHAKWRLCAASAICFIFMVAEVVGGHVAGSLAILTDAAHLLIDLTSFLLSLFSLWLSSRPPSKRLTFGWYRAEILGALLSVLCIWVVTGVLLYLACERLLYPDYQIQAGIMITVSGCAVAANIVLTMILHQRNFGYNHKDVQANASVRAAFVHALGDVFQSISVLISALIIYFKPDYKIADPVCTFIFSILVLASTVMILKDFSILLMEGVPKGLSYNSVKEIILAVDGVISVHSLHIWSLTVNQVILSVHVATAASQDSQSVRTGIAQALSSFDLHSLTIQIESAADQDPSCLLCEDPQD

Tissue specificity:Expressed in endocrine pancreatic islet alpha and beta cells. Not detected in the brain. {ECO:0000269|PubMed:16984975, ECO:0000269|PubMed:18250168, ECO:0000269|PubMed:19095428}.

Induction:

Developmental stage:

Protein families:Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily


   💬 WhatsApp