ZNT6_MOUSE Q8BJM5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BJM5
Recommended name:Zinc transporter 6
EC number:
Alternative names:(ZnT-6) (Solute carrier family 30 member 6)
Cleaved into:
GeneID:210148
Gene names (primary ):Slc30a6
Gene names (synonym ):Znt6
Gene names (ORF ):
Length:460
Mass:51027
Sequence:MGTIHLFRKPQRSFFGKLLQEFRLVAADRRSWKILLFGAINVLCTGFLLMWCSSTNSIALTAYTYLTIFDLFSLITCLISYWVMMRKPSPVYSFGFERLEVLAVFASTVLAQLGALFILKESAERFLEQPEIHTGRLLVGTFVALSFNLFTMLSIRNKPFAYVSEAASTSWLQEHVADLSRSLCGLIPGLSSIFLPRMNPFVLIDLAGAFALCITYMLIEINNYFAVDTASAIAIALMTFGTMYPMSVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVSNRLCTLVSTLTVQIFKDDWIRPALSSGPVAPNVLNFSDHHVIPMPLLKNVDERTPVTSTPAKPSSPPPEFSFNTPGKNVSPVILLNTQTRPYSLGLNRGHTPYSSVFSQGLAFPGVGAGQGLRPTFPHIPSRYGINRMGQPRP
Tissue specificity:Expressed in brain and liver, and to a lower extent also in lung. Highly expressed in brain (at protein level). {ECO:0000269|PubMed:11997387}.
Induction:
Developmental stage:
Protein families:Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily