ZN639_MOUSE   Q99KZ6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99KZ6

Recommended name:Zinc finger protein 639

EC number:

Alternative names:(Zinc finger protein ZASC1)

Cleaved into:

GeneID:67778

Gene names  (primary ):Znf639

Gene names  (synonym ):Zasc1 Zfp639

Gene names  (ORF ):

Length:485

Mass:55678

Sequence:MNEYPKKRKRKTLHPSRYSDSSGISRIADGVSGIFSDHCYSVCSMRQPDLKYFDNKDDDSDPETANDLPKFADGTKARNRNQSYLVPSPVLRILDHTVFSTEKSTEVEICDEECASPESVHQHTQEESPIEVHTSEDVPIAVEVHAISEDYDIEAENNSSESLQDQADEEPPAKLCKILDKGQALNVTAQQKWPLLRANSSGLYKCELCEFNSKYFSDLKQHVILKHKRTDSNVCRVCKESFSTNMLLIEHAKLHEEDPYICKYCDYKTVIFENLSQHIADTHFSDHLYWCEQCDVQFSSSSELYLHFQEHSRDEQYLCQFCEHETGDPEDLHSHVVNEHARRLIELSDKCGSGGHGQCSLLSKITFDKCKNFFVCQVCGFRSRLHTNVNRHVAIEHTKIFPHVCDDCGKGFSSMLEYCKHLNSHLSEGIYLCQYCEYSTGQIDDLKIHLDFKHSADLPHKCSECLMRFGNERDLLGHLQVHETT

Tissue specificity:

Induction:

Developmental stage:

Protein families:Krueppel C2H2-type zinc-finger protein family


   💬 WhatsApp