ZDH19_MOUSE   Q810M5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q810M5

Recommended name:Palmitoyltransferase ZDHHC19

EC number:EC 2.3.1.225

Alternative names:(Zinc finger DHHC domain-containing protein 19) (DHHC-19)

Cleaved into:

GeneID:245308

Gene names  (primary ):Zdhhc19

Gene names  (synonym ):Gm616

Gene names  (ORF ):

Length:347

Mass:39009

Sequence:MPFLKDAVTLVKEPQQLPSIPLSWFPSSVFAAFNVTLLLFLSGLFFGFPCRWLVQNGEWAFPAITGPLFILTFFSLVSLNFSDPGILHRGSTKEDPMTVHVVRVNQRAFRLEWCPKCLFHRPPRTYHCPWCNICVEDFDHHCKWVNNCIGHRNFRLFMLLVLSLCLYSGALLVTCLTFLFRTRHLPFSLDKGMAILVAVPAAGFLIPLFLLLLIQALSVSRAESSYESKCRYHPEYNPFDQGFAKNWYLAMFAPLGPNYMSEVVCLQRPVGTAWIQEKTKPSPPRRPKHCRPGPPGPQHQPRRVPGKGPPGSGEAAALQEMRRLPASVEKSPGGPRQPTAEPAAGDP

Tissue specificity:

Induction:

Developmental stage:

Protein families:DHHC palmitoyltransferase family


   💬 WhatsApp