YIPF7_MOUSE   Q9JIM5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JIM5

Recommended name:Protein YIPF7

EC number:

Alternative names:(YIP1 family member 7)

Cleaved into:

GeneID:75581

Gene names  (primary ):Yipf7

Gene names  (synonym ):Yip1b

Gene names  (ORF ):

Length:254

Mass:27490

Sequence:MSNPEQYDMGFYQSNYIIDNQEPSCNDSNAYGNVYGYREPQATEQPSSPAPPEMFLPSDYGGQLFQPASNLDYYSQSPSVDTFDEEPPLLEELGINFDHIWQKTLTVLNPMKPADGSIMNETDLTGPILFCVALGATLLMAGKAQFGYVYGMSAIGCLGIHALLNLMSNSGVSYGCVASVLGYCLLPMVLLSSCAVFFSLQGTIGTMSALLIITWCSLSASKIFISALAMEGQQLLVAYPCALLYGLFALLTVF

Tissue specificity:Specifically expressed in the heart. {ECO:0000269|PubMed:11489904}.

Induction:

Developmental stage:

Protein families:YIP1 family


   💬 WhatsApp