TYY2_MOUSE Q3TTC2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3TTC2
Recommended name：Transcription factor YY2
EC number：
Alternative names：(Yin and yang 2) (YY-2)
Cleaved into：
GeneID：100073351
Gene names (primary )：Yy2
Gene names (synonym )：
Gene names (ORF )：
Length：378
Mass：42031
Sequence：MASETEKLLCLNTESAEIPADFVELLPPDNIGDIEAVSLETSVGQTIEVYGDVGVDWAHGSQYHSPVIALQPLVGSSLSSRDHDKEMFVVQTREEEVVGYQDSDNLLFSPEFGSQMVLPVNEDDYLQPTTASFTGFLAAENGQGELSPYEGNLCGLTTFIEAGAEESVNADLGDKQWEQKQIDGLDGEFPFTMWDDVNEKEDPIAEEQAGESPPDYSEYMTGKKFPPEGIPGIDLSDPKQLAEFTSMRPKKPKGDFPRPIACSHKGCEKMFKDNSAMRKHLHIHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPYQCTFEGCGRRFSLDFNLRTHVRIHTGDKPFVCPFDACNKKFAQSTNLKSHILTHVKNKNDQ
Tissue specificity：Weakly expressed by neuronal and glial cells in the cerebral cortex. Expressed by Purkinje cells and in the granular layers of the cerebellum. Expressed in all layers of spermatocytes in testis but not detected in sperm cells. {ECO:0000269|PubMed:16377127}.
Induction：
Developmental stage：
Protein families：YY transcription factor family