CE049_MOUSE   Q9DAR0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9DAR0

Recommended name:Uncharacterized protein C5orf49 homolog

EC number:

Alternative names:(Y regulated sperm protein)

Cleaved into:

GeneID:69315

Gene names  (primary ):

Gene names  (synonym ):

Gene names  (ORF ):

Length:182

Mass:20848

Sequence:MEELAKKERRAMDPGGLKKEGKVEEEAGKEEGREEEGGEEEEVTSETLRGKPRPLPISALPAFSYIPPRHQGPKERSYFSREGQTGIVSLYDCVFKRRLDYNQKLHRDDREHAKNLGLHINEEEQERTVPVLMSSVYGKRINQPIEPLNRDYGHVSHVKTDFYRKNEIPSIKGPGFGHINPA

Tissue specificity:Expressed in sperm (at protein level). {ECO:0000269|Ref.3}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp