XRCC4_MOUSE   Q924T3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q924T3

Recommended name:DNA repair protein XRCC4

EC number:

Alternative names:(X-ray repair cross-complementing protein 4)

Cleaved into:

GeneID:108138

Gene names  (primary ):Xrcc4

Gene names  (synonym ):

Gene names  (ORF ):

Length:326

Mass:37061

Sequence:MERKVSRIYLASEPNVPYFLQVSWERAIGSGFVITLTDGHSAWTATVSELEISQEADDMAMEKGKYIDELRKALVPGSGAAGTYKFLFSKESQHFSLEKELKDVSFRLGSFNLDKVSNSAEVIRELICYCLDTITEKQAKNEHLQKENERLLRDWNDVQGRFEKCVSAKEALEADLYQRFILVLNEKKTKIRSLHKLLNEVQQLEESTKPERENPCSDKTPEEHGLYDGSTDEESGAPVQAAETLHKDDSIFSSPDVTDIAPSRKRRHRMQKNLGTEPKMAPQELPLQEKERLASSLPQTLKEESTSAENMSLETLRNSSPEDLFD

Tissue specificity:

Induction:

Developmental stage:

Protein families:XRCC4 family


   💬 WhatsApp