XLRS1_MOUSE   Q9Z1L4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Z1L4

Recommended name:Retinoschisin

EC number:

Alternative names:(X-linked juvenile retinoschisis protein homolog)

Cleaved into:

GeneID:20147

Gene names  (primary ):Rs1

Gene names  (synonym ):Rs1h Xlrs1

Gene names  (ORF ):

Length:224

Mass:25575

Sequence:MPHKIEGFFLLLLFGYEATLGLSSTEDEGEDPWYQKACKCDCQVGANALWSAGATSLDCIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKYQDSSQWLQIDLKEIKVISGILTQGRCDIDEWVTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRSSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECASKCA

Tissue specificity:Detected in the eye cup (PubMed:11983912). Detected in retina, in the inner segment of the photoreceptors, the inner nuclear layer, the inner plexiform layer and the ganglion cell layer (at protein level) (PubMed:10915776, PubMed:11983912, PubMed:17325137). Restricted to the retina (PubMed:10023077, PubMed:10915776). At the mRNA level, detected only within the photoreceptor cell layer, most prominently within the inner segments of the photoreceptors (PubMed:10023077, PubMed:10915776). Undetectable in the inner plexiform layers and the inner nuclear layer (PubMed:10915776). {ECO:0000269|PubMed:10023077, ECO:0000269|PubMed:10915776, ECO:0000269|PubMed:11983912, ECO:0000269|PubMed:17325137}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp