WASF3_MOUSE   Q8VHI6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8VHI6

Recommended name:Wiskott-Aldrich syndrome protein family member 3

EC number:

Alternative names:(WASP family protein member 3) (Protein WAVE-3)

Cleaved into:

GeneID:245880

Gene names  (primary ):Wasf3

Gene names  (synonym ):Wave3

Gene names  (ORF ):

Length:501

Mass:55204

Sequence:MPLVKRNIEPRHLCRGALPEGVTSELECVTNSTLAAIIRQLSSLSKHAEDIFGELFNEANNFYIRANSLQDRIDRLAVKVTQLDSTVEEVSLQDINMKKAFKSSTIQDQQVVSKNSIPNPVADIYNQSDKPPPLSILTPYRDDKKDGLKFYTDPSYFFDLWKEKMLQDTEDKRKEKRRQKEQKRVDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVHHGASSEGSLSPDTRSHTSDVTDYSYPATPNHALQAQPATPSYTAGDAPLHGTTNQGAEHEYRPSSASARHMALNRPQQPPPPPPPQAPEGSQASTSVAPADYGMLPAQIIEYYSPSGPPPPPPPPMIPSAQTAFVSPLQMPTQPPFPASAVSTYPTPPHQPSTGLLATAPPPPGPPPPPPGPPGPSSLSSSPMHGPPVAEAKRPEPAQPPISDARSDLLAAIRMGIQLKKVQEQREQEAKREPVGNDVATILSRRIAVEYSDSDDDSEFDENDWSD

Tissue specificity:

Induction:

Developmental stage:

Protein families:SCAR/WAVE family


   💬 WhatsApp