V1R47_MOUSE   Q9EQ51


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9EQ51

Recommended name:Vomeronasal type-1 receptor 47

EC number:

Alternative names:(Vomeronasal type-1 receptor A4) (Vomeronasal type-1 receptor A7)

Cleaved into:

GeneID:113846

Gene names  (primary ):Vmn1r47

Gene names  (synonym ):V1ra4 V1ra7

Gene names  (ORF ):

Length:310

Mass:35433

Sequence:MNENSRLHTHSNIRNTFFSEIGIGISGNSFLLLFHIIKFFRGHRPRLTDLPIGLLSLIHLLMLLVAAVIATDIFISWRGWNDIICKFLVYLYRSLRGLSLCTTSMLSVLQAIILSPRSYCLAKFKRKSSHNISCAIIFLSVLYMSISSHLFISITATLNLTMNNFLYVSQSCSLLPLSYLMQSMYSTLLVLREVFLIGLMVLSTSYMVALLCMHRKQAQNLQGTSLSLKTAPEQRATQTILMLMTFFVLMSIFDSIVSSSRAMFLDDSTCYSIYIFVMHIYATVSPFVFMSTEKHLVNFFRSMCEWIINM

Tissue specificity:

Induction:

Developmental stage:

Protein families:G-protein coupled receptor 1 family


   💬 WhatsApp