S27A2_MOUSE O35488
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35488
Recommended name：Very long-chain acyl-CoA synthetase
EC number：EC 6.2.1.-
Alternative names：(VLACS) (VLCS) (Arachidonate--CoA ligase) (Fatty acid transport protein 2) (FATP-2) (Fatty-acid-coenzyme A ligase, very long-chain 1) (Long-chain-fatty-acid--CoA ligase) (Phytanate--CoA ligase) (Solute carrier family 27 member 2) (THCA-CoA ligase) (Very long-chain-fatty-acid-CoA ligase)
Cleaved into：
GeneID：26458
Gene names (primary )：Slc27a2
Gene names (synonym )：Acsvl1 Facvl1 Fatp2 Vlacs Vlcs
Gene names (ORF )：
Length：620
Mass：70423
Sequence：MLPVLYTGLAGLLLLPLLLTCCCPYLLQDVRYFLRLANMARRVRSYRQRRPVRTILRAFLEQARKTPHKPFLLFRDETLTYAQVDRRSNQVARALHDQLGLRQGDCVALFMGNEPAYVWIWLGLLKLGCPMACLNYNIRAKSLLHCFQCCGAKVLLASPDLQEAVEEVLPTLKKDAVSVFYVSRTSNTNGVDTILDKVDGVSAEPTPESWRSEVTFTTPAVYIYTSGTTGLPKAATINHHRLWYGTGLAMSSGITAQDVIYTTMPLYHSAALMIGLHGCIVVGATLALRSKFSASQFWDDCRKYNVTVIQYIGELLRYLCNTPQKPNDRDHKVKKALGNGLRGDVWREFIKRFGDIHVYEFYASTEGNIGFVNYPRKIGAVGRANYLQRKVARYELIKYDVEKDEPVRDANGYCIKVPKGEVGLLVCKITQLTPFIGYAGGKTQTEKKKLRDVFKKGDIYFNSGDLLMIDRENFVYFHDRVGDTFRWKGENVATTEVADIVGLVDFVEEVNVYGVPVPGHEGRIGMASLKIKENYEFNGKKLFQHIAEYLPSYARPRFLRIQDTIEITGTFKHRKVTLMEEGFNPTVIKDTLYFMDDAEKTFVPMTENIYNAIIDKTLKL
Tissue specificity：Strong expression in liver and kidney (at protein level) (PubMed:20530735, PubMed:11980911, PubMed:9671728). Lower expression in brain and testis, no expression in skeletal muscle and spleen (PubMed:11980911). Shows uniform distribution in liver acinus (PubMed:11980911). {ECO:0000269|PubMed:11980911, ECO:0000269|PubMed:20530735, ECO:0000269|PubMed:9671728}.
Induction：
Developmental stage：
Protein families：ATP-dependent AMP-binding enzyme family