VDAC3_MOUSE Q60931
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q60931
Recommended name：Voltage-dependent anion-selective channel protein 3
EC number：
Alternative names：(VDAC-3) (mVDAC3) (Outer mitochondrial membrane protein porin 3)
Cleaved into：
GeneID：22335
Gene names (primary )：Vdac3
Gene names (synonym )：
Gene names (ORF )：
Length：283
Mass：30753
Sequence：MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYRRDCFSLGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQLHTHVNDGTEFGGSIYQKVNERIETSINLAWTAGSNNTRFGIAAKYKLDCRTSLSAKVNNASLIGLGYTQTLRPGVKLTLSALIDGKNFNAGGHKVGLGFELEA
Tissue specificity：Highest levels of expression detected in testis, less but still abundant expression in heart, kidney, brain, and skeletal muscle.
Induction：
Developmental stage：
Protein families：Eukaryotic mitochondrial porin family