V1BR_MOUSE   Q9WU02


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9WU02

Recommended name:Vasopressin V1b receptor

EC number:

Alternative names:(V1bR) (AVPR V1b) (AVPR V3) (Antidiuretic hormone receptor 1b) (Vasopressin V3 receptor)

Cleaved into:

GeneID:26361

Gene names  (primary ):Avpr1b

Gene names  (synonym ):V1br

Gene names  (ORF ):

Length:421

Mass:46539

Sequence:MDSEPSWTATPSPGGTLFVPNTTTPWLGRDEELAKVEIGILATVLVLATGGNLAVLLILGLQGHKRSRMHLFVLHLALTDLGVALFQVLPQLLWDITYRFQGSDLLCRAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPLRSLQQPSQSTYPLIAAPWLLAAILSLPQVFIFSLREVIQGSGVLDCWADFYFSWGPRAYITWTTMAIFVLPVVVLTACYGLICHEIYKNLKVKTQAGREERRGWPKSSSSAAAAATRGLPSRVSSISTISRAKIRTVKMTFVIVLAYIACWAPFFSVQMWSVWDENAPNEDSTNVAFTISMLLGNLSSCCNPWIYMGFNSHLLPRSLSHRACCRGSKPRVHRQLSNSSLASRRTTLLTHTCGPSTLRLSLNLSLHAKPKPAGSLKDLEQVDGEATMETSIS

Tissue specificity:

Induction:

Developmental stage:

Protein families:G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily


   💬 WhatsApp