UCN3_MOUSE Q924A4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q924A4
Recommended name：Urocortin-3
EC number：
Alternative names：(Urocortin III) (Ucn III)
Cleaved into：
GeneID：83428
Gene names (primary )：Ucn3
Gene names (synonym )：
Gene names (ORF )：
Length：164
Mass：18063
Sequence：MLMPTYFLLPLLLLLGGPRTSLSHKFYNTGPVFSCLNTALSEVKKNKLEDVPLLSKKSFGHLPTQDPSGEEDDNQTHLQIKRTFSGAAGGNGAGSTRYRYQSQAQHKGKLYPDKPKSDRGTKFTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQIGKKK
Tissue specificity：Expressed in some areas of the brain including the hypothalamus, amygdala, and brainstem, but is not evident in the cerebellum, pituitary, or cerebral cortex; it is also expressed peripherally in small intestine and skin. {ECO:0000269|PubMed:11416224}.
Induction：
Developmental stage：
Protein families：Sauvagine/corticotropin-releasing factor/urotensin I family