UPK1B_MOUSE   Q9Z2C6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Z2C6

Recommended name:Uroplakin-1b

EC number:

Alternative names:(UP1b) (Uroplakin Ib) (UPIb)

Cleaved into:

GeneID:22268

Gene names  (primary ):Upk1b

Gene names  (synonym ):

Gene names  (ORF ):

Length:260

Mass:29762

Sequence:MAKDDSTVRCFQGLLIFGHVIVGMCGIALTAECIFFVSDQHSLYPLLEATNNDDIFGAAWIGMFVGICLFCLSVLAIVGIMKSNRKILLAYFIMMFIVYGFEVASCITAATQRDFFTTNLFLKQMLMRYQNNSPPTNDDEWKNNGVTKTWDRLMLQDHCCGVNGPSDWQKYTSAFRVENNDADYPWPRQCCVMDKLKEPLNLDACKLGVPGYYHSQGCYELISGPMDRHAWGVAWFGFAILCWTFWVLLGTMFYWSRIEY

Tissue specificity:Bladder epithelium.

Induction:

Developmental stage:

Protein families:Tetraspanin (TM4SF) family


   💬 WhatsApp