KRA51_MOUSE Q64507
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64507
Recommended name：Keratin-associated protein 5-1
EC number：
Alternative names：(Ultra high sulfur serine protein 1) (UHS-Ser-1)
Cleaved into：
GeneID：50774
Gene names (primary )：Krtap5-1
Gene names (synonym )：
Gene names (ORF )：
Length：230
Mass：21782
Sequence：MTCCGCSGGCGSSCGGCGSSCGGCGSGCGGCGSNCGGCGSSCCKPVCCCKPVCCCVPVCSCSSCGGCGSSCGGCGSCGSSCGGCGSSCCKPVCCCVPVCSCSSCGGCKPCCCQSSCCKPCCSSGCGSSCCQSSCCKPCCCQSSCCKPCCCQSSCCKPCCSSGCGSSCCQSSCCKPCCCQSSCCKPCCCQSSCCKPCCCQSSCCKPCCCQSSCCKPCCSSGCGSSCCQDSC
Tissue specificity：Expressed during the active phases of the hair cycle in the medulla and the inner root sheath of the forming hair. Also expressed in the upper layers of the epidermis of skin. {ECO:0000269|PubMed:2250030}.
Induction：
Developmental stage：
Protein families：KRTAP type 5 family