UD19_MOUSE Q62452
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62452
Recommended name：UDP-glucuronosyltransferase 1A9
EC number：EC 2.4.1.17
Alternative names：(UGT1A9) (UDP-glucuronosyltransferase 1-7) (UDPGT) (UDP-glucuronosyltransferase 1-9) (UDPGT 1-9) (UGT1*9) (UGT1-09) (UGT1.9) (UGT1A12) (UGTP4)
Cleaved into：
GeneID：394434
Gene names (primary )：Ugt1a9
Gene names (synonym )：Ugt1 Ugt1a12
Gene names (ORF )：
Length：528
Mass：60008
Sequence：MAPVAFPTSFFLCLLLASGLAQAGRLLVVPMDGSHWFTMQMVVEKLIHRGHEVVVVIPEVSWQLGKSLNCTVKTYSISHTLEDLDREFKYLSYTQWKTPEHSIRSFLTGSARGFFELTFSHCRSLFNDKKLVEYLKQRFFDAVFLDPFDVCGLIVAKYFSLPSVIFARGVFCDYLEEGAQCPSLPSYVPRLFSKYTDTMTFKERVWNHLIYIEEHAFCSYFLRTAVEVASEILQTPVTMTDLFSPVSIWLLRTDFVLEFPRPVMPNMVFIGGINCLQKKSLSKEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLGHPKTRAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVFKCCAYGCRKCFGGKGRVKKSHKSKTH
Tissue specificity：Highly expressed in liver and at lower levels in stomach and kidney. {ECO:0000269|PubMed:14672974}.
Induction：
Developmental stage：
Protein families：UDP-glycosyltransferase family