GUC2B_MOUSE   O09051


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O09051

Recommended name:Guanylate cyclase activator 2B [Cleaved into: Uroguanylin

EC number:

Alternative names:(UGN)]

Cleaved into:

GeneID:14916

Gene names  (primary ):Guca2b

Gene names  (synonym ):

Gene names  (ORF ):

Length:106

Mass:11628

Sequence:MSRSQLWAAVVLLLLLQSAQGVYIKYHGFQVQLESVKKLNELEEKEMSNPQPRRSGLLPAVCHNPALPLDLQPVCASQEAASTFKALRTIATDECELCINVACTGC

Tissue specificity:Localized predominantly in intestinal villi and the corticomedullary junction of the kidney.

Induction:

Developmental stage:

Protein families:Guanylin family


   💬 WhatsApp