UFSP1_MOUSE Q9CZP0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CZP0
Recommended name:Ufm1-specific protease 1
EC number:EC 3.4.22.-
Alternative names:(UfSP1) (EC 3.4.22.-)
Cleaved into:
GeneID:70240
Gene names (primary ):Ufsp1
Gene names (synonym ):D5Ertd655e
Gene names (ORF ):
Length:217
Mass:23421
Sequence:MTAALPSTLELLKDVHLGLPVPCHDPARLALLSGHYLYYHYGCDGLDDRGWGCGYRTLQTLCSWPGGQSSGVPGLPALQGALEAMGDKPPGFRGSRNWIGCVEASLCLEHFGGPQGRLCHLPRGVGLRGEEERLYSHFTTGGGPVMVGGDADAQSKALLGICEGPGSEVYVLILDPHYWGTPKNRCELQAAGWVGWQKVKSVFDSNSFYNLCFTRNL
Tissue specificity:Widely expressed. Expressed at higher level in brain, heart, kidney and skeletal muscle. {ECO:0000269|PubMed:17182609}.
Induction:
Developmental stage:
Protein families:Peptidase C78 family