S35B1_MOUSE   P97858


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P97858

Recommended name:Solute carrier family 35 member B1

EC number:

Alternative names:(UDP-galactose translocator 2) (UDP-galactose transporter-related protein 1) (UGTrel1)

Cleaved into:

GeneID:110172

Gene names  (primary ):Slc35b1

Gene names  (synonym ):Ugalt2

Gene names  (ORF ):

Length:322

Mass:35883

Sequence:MAASRSLVPDRLRLPLCFLGVFVCYFYYGILQEKITRGKYGEGPKQETFTFALTLVFIQCVINAMFAKILIQFFDTARVDRTRTWLYAACSVSYVGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYPLAKYLCVLLIVAGVALFMYKPKKVVGIEEHTVGFGELLLLMSLTLDGLTGVSQDHMRAHYQTGSNHMMLNINLWSTFLLGAGILFTGELWEFLSFAERYPTIIYNILLFGLTSALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISSMQWVGTVLVFLGLGLDAKFGKGTKKTSH

Tissue specificity:

Induction:

Developmental stage:

Protein families:Nucleotide-sugar transporter family, SLC35B subfamily


   💬 WhatsApp