UBX10_MOUSE   Q8BG34


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BG34

Recommended name:UBX domain-containing protein 10

EC number:

Alternative names:(UBX domain-containing protein 3)

Cleaved into:

GeneID:212190

Gene names  (primary ):Ubxn10

Gene names  (synonym ):Ubxd3

Gene names  (ORF ):

Length:277

Mass:30341

Sequence:MAIEAPVNFAPPERSTVVSTAGDSSTWQPSSLRMHVIRPKSAKGRKRPNLHRPQGMGDGSPSALSSSPPPRSSGSPSNQKPGVCATVSTSQGAPDEMPELLLQQAPTRTASSLNRYPVLPSINRRSLEVGAVDTVASKTSSLQLSSVQALYQEDSSQEDSRTQVCALEKKFIIRTKRQSSSRASNIEEPSDEEPRLLLAVRSPSGQRFVRYFRPSDDLQTVLEVAEQKNKATYQHCSIETMEVPRRRFSDLTKSLQECGILHKSVLGISQEEGEAWP

Tissue specificity:

Induction:

Developmental stage:

Protein families:UBXN10 family


   💬 WhatsApp