UBL4A_MOUSE   P21126


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P21126

Recommended name:Ubiquitin-like protein 4A

EC number:

Alternative names:(Ubiquitin-like protein GDX)

Cleaved into:

GeneID:100169864

Gene names  (primary ):Ubl4a

Gene names  (synonym ):Gdx Ubl4

Gene names  (ORF ):

Length:157

Mass:17801

Sequence:MQLTVKALQGRECSLQVAEDELVSTLKHLVSDKLNVPVRQQRLLFKGKALADEKRLSDYNIGPNSKLNLVVKPLEKVLLEEGSAHRLVDSPATPIWQLISKVLARHFSVADASRVLEQLQRDYDRSLSRLTLDDIERLASRFLHPEVTEAMEKGFCK

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp