RS27A_MOUSE P62983
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P62983
Recommended name：Ubiquitin-40S ribosomal protein S27a
EC number：
Alternative names：(Ubiquitin carboxyl extension protein 80)
Cleaved into：Ubiquitin; 40S ribosomal protein S27a
GeneID：78294
Gene names (primary )：Rps27a
Gene names (synonym )：Uba80 Ubcep1
Gene names (ORF )：
Length：156
Mass：17951
Sequence：MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMGSHFDRHYCGKCCLTYCFNKPEDK
Tissue specificity：
Induction：
Developmental stage：
Protein families：Ubiquitin family; Eukaryotic ribosomal protein eS31 family