TZAP_MOUSE   Q1H9T6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q1H9T6

Recommended name:Telomere zinc finger-associated protein

EC number:

Alternative names:(TZAP) (Krueppel-related zinc finger protein 3 homolog) (Zinc finger and BTB domain-containing protein 48)

Cleaved into:

GeneID:100090

Gene names  (primary ):Zbtb48

Gene names  (synonym ):Hkr3 Tzap

Gene names  (ORF ):

Length:681

Mass:76800

Sequence:MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHFFQRIYGDGTGGSVVLPAGFAEIFGLLLDFFYTGHLALTSGNRDQVLLAAKELRVPEAVELCQSFQPQTSVGQAQSGLGQPASQDVKSHLKEPTDLDEEEVFRTLSLASVDQEPRDTEQPQLGTPAQSTTAFLCGKLTQALKPSPSEDKESEDCKEPPRPFEAGGAPLQGESNEWEVVVQVEDDRDGDYVSEPETVLTRRKSKVIRKPCAAEPALGAGSLTAEPTDSRKGAAVPVECPTCHKKFLSKYYLKVHNRKHTGEKPFECPKCGKCYFRKENLLEHEARNCMNRSEQVFTCSVCQETFRRRMELRLHMVSHTGEMPYKCSSCSQQFMQKKDLQSHMIKLHGAPKPHACPTCAKCFLSRTELQLHEAFKHRGEKLFVCEECGHRASSRNGLQMHIKAKHRNERPYVCEFCSHAFTQKANLNMHLRTHTGEKPFQCHLCGKTFRTQASLDKHNRTHTGERPFSCEFCEQRFTEKGPLLRHVASRHQEGRPHFCQICGKTFKAVEQLRVHVRRHKGVRKFECTECGYKFTRQAHLRRHMEIHDRVENYNPRQRKLRNLIIEDEKMVVVALQPPADLEVGSAEVIVESLTQGGLASQLPSQRLCSEESFASPGVLEPSLIITAAVPEDCDT

Tissue specificity:

Induction:

Developmental stage:

Protein families:Krueppel C2H2-type zinc-finger protein family


   💬 WhatsApp