TSSK6_MOUSE   Q925K9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q925K9

Recommended name:Testis-specific serine/threonine-protein kinase 6

EC number:EC 2.7.11.1

Alternative names:(TSK-6) (TSSK-6) (Testis-specific kinase 6) (Serine/threonine-protein kinase SSTK) (Small serine/threonine kinase)

Cleaved into:

GeneID:83984

Gene names  (primary ):Tssk6

Gene names  (synonym ):Sstk

Gene names  (ORF ):

Length:273

Mass:30287

Sequence:MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGSQARELFSQIAGAVRYLHDHHLVHRDLKCENVLLSPDERRVKITDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSLGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPDGLELSERCKSLIAELLQFSPSARPSAGQVARNGWLRAGDSG

Tissue specificity:Expressed in the testis, localized to the heads of elongating spermatids. {ECO:0000269|PubMed:15870294}.

Induction:

Developmental stage:

Protein families:Protein kinase superfamily, CAMK Ser/Thr protein kinase family


   💬 WhatsApp