MBNL1_MOUSE   Q9JKP5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JKP5

Recommended name:Muscleblind-like protein 1

EC number:

Alternative names:(Triplet-expansion RNA-binding protein)

Cleaved into:

GeneID:56758

Gene names  (primary ):Mbnl1

Gene names  (synonym ):Exp Mbnl

Gene names  (ORF ):

Length:341

Mass:36976

Sequence:MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATSASAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVDTHNICRTSD

Tissue specificity:Highly expressed in cardiac and skeletal muscle. Weakly expressed in heart and eye (at protein level). {ECO:0000269|PubMed:10970838}.

Induction:

Developmental stage:

Protein families:Muscleblind family


   💬 WhatsApp