TPC6A_MOUSE   Q78XR0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q78XR0

Recommended name:Trafficking protein particle complex subunit 6A

EC number:

Alternative names:(TRAPP complex subunit 6A)

Cleaved into:

GeneID:67091

Gene names  (primary ):Trappc6a

Gene names  (synonym ):

Gene names  (ORF ):

Length:159

Mass:17430

Sequence:MADAVLFEFLHTEMVAELWAPDPDPGSGGKRRSLSVLEGLGFRVGQALGERLPLETPAFREELDALKFLCRDLWAAMFQKHMDGLRTNHQGTYVLQDNSFPLLVTMGSGPQYLEEAPKFLAFTCGLLCGALHTLGFQSLVTASVASLPACKFQVVIQKS

Tissue specificity:Ubiquitous, with lowest expression in skeletal muscle and brain and highest in kidney, liver and testis, as well as in cultured melanocytes. {ECO:0000269|PubMed:16697553}.

Induction:

Developmental stage:

Protein families:TRAPP small subunits family, BET3 subfamily


   💬 WhatsApp